You have no items in your shopping cart.
Cart summary
NFIA Peptide - middle region
Catalog Number: orb1999283
| Catalog Number | orb1999283 |
|---|---|
| Category | Proteins |
| Description | NFIA Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: PSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPN |
| UniProt ID | Q12857 |
| MW | 55 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CTF, NF1-A, NFI-A, NFI-L, BRMUTD, NF-I/A |
| Note | For research use only |
| NCBI | NP_001128145.1 |
