You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592877 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NFE2L1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NFE2L1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 85kDa |
Target | NFE2L1 |
UniProt ID | Q14494 |
Protein Sequence | Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP |
NCBI | NP_003195 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NRF1, TCF11, LCR-F1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
NFE2L1 (nuclear factor (erythroid-derived 2)-like 1) Antibody (against the middle region of NFE2L1) (50 ug) validated by WB using Jurkat cell lysate at 0.2-1 ug/ml.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |