NFATC4 Rabbit Polyclonal Antibody

• Catalog Number: orb329986
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NFATC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95kDa
• Target: NFATC4
• UniProt ID: Q14934
• Protein Sequence: Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE
• NCBI: NP_004545
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NF-ATc4 antibody, anti NFAT3 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

NFATC4 antibody - N-terminal region (orb329986), Catalog Number: orb329986, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-NFATC4 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.