You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587844 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NEURL1B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEURL1B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | NEURL1B |
UniProt ID | A8MQ27 |
Protein Sequence | Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | neur2, NEURL3, RNF67B, hNeur2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
ICC, IF | |
Bovine, Human, Mouse, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Human, Mouse, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy3 |