NEU1 Rabbit Polyclonal Antibody

• Catalog Number: orb421977
• Category: Antibodies
• Description: Rabbit polyclonal antibody against NEU1.
• Target: NEU1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEU1
• Protein Sequence: Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
• UniProt ID: Q99519
• MW: 45 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti-NEU antibody, anti-SIAL1 antibody, anti-NANH
• Note: For research use only
• NCBI: NP_000425

Human Muscle

Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is processed to ~40 kDa.

WB Suggested Anti-NEU1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal Pancreas cell lysate.