You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb421977 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody against NEU1. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NEU1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45 kDa |
Target | NEU1 |
UniProt ID | Q99519 |
Protein Sequence | Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
NCBI | NP_000425 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti-NEU antibody, anti-SIAL1 antibody, anti-NANH Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Muscle
Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is processed to ~40 kDa.
WB Suggested Anti-NEU1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal Pancreas cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Human, Mouse, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |