You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb421977 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody against NEU1. |
| Target | NEU1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NEU1 |
| Protein Sequence | Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
| UniProt ID | Q99519 |
| MW | 45 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti-NEU antibody, anti-SIAL1 antibody, anti-NANH Read more... |
| Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_000425 |

Human Muscle

Sample Tissue: Human ACHN, Antibody dilution: 1.0 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is processed to ~40 kDa.

WB Suggested Anti-NEU1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal Pancreas cell lysate.
WB | |
Bovine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Human, Mouse, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review