NETO1 Rabbit Polyclonal Antibody

• Catalog Number: orb584466
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NETO1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60kDa
• Target: NETO1
• UniProt ID: Q8R4I7
• Protein Sequence: Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI
• NCBI: NP_620416
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BCTL1, BTCL1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Brain (BR), Negative control (-): HeLa cell lysate (HL), Antibody concentration: 1 ug/ml.

Immunohistochemistry with mice retinal neurons tissue at an antibody concentration of researcher doesn't say using anti-NETO1 antibody (orb584466).

WB Suggested Anti-NETO1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.