You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580239 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NDRG2 |
Target | NDRG2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NDRG2 |
Protein Sequence | Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG |
UniProt ID | Q9UN36 |
MW | 39kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SYLD |
Research Area | Epigenetics & Chromatin, Molecular Biology, Neuros Read more... |
Note | For research use only |
NCBI | NP_057334 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Liver
WB Suggested Anti-NDRG2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |