You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325263 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NDC1 |
| Target | NDC1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMEM48 |
| Protein Sequence | Synthetic peptide located within the following region: SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD |
| UniProt ID | Q9BTX1 |
| MW | 76kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ10407 antibody, anti FLJ12556 antibody, an Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_060557 |

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Isoforms at 88 kDa, 76 kDa, 72 kDa, and 63 kDa contain the peptide sequence.

WB Suggested Anti-TMEM48 Antibody Titration: 0.2-1 ug/mL, Positive Control: THP-1 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Feline, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Feline, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Canine, Equine, Feline, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Bovine, Canine, Equine, Feline, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review