NCOA3 Rabbit Polyclonal Antibody

• Catalog Number: orb574233
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NCOA3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCOA3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 155kDa
• Target: NCOA3
• UniProt ID: Q0VF45
• Protein Sequence: Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL
• NCBI: NP_006525
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACTR, AIB1, RAC3, SRC3, pCIP, AIB-1, CTG26, SRC-3,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. NCOA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Immunohistochemistry with Human Tonsil lysate tissue at an antibody concentration of 5.0 ug/ml using anti-NCOA3 antibody (orb574233).

WB Suggested Anti-NCOA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.