NACC1 antibody

• Catalog Number: orb324816
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NACC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD14B
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: NACC1
• UniProt ID: Q96RE7
• Protein Sequence: Synthetic peptide located within the following region: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAE
• NCBI: NP_443108
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NAC1 antibody, anti BEND8 antibody, anti NAC-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human kidney tissue using NACC1 antibody

Western blot analysis of HepG2 cell lysate tissue using NACC1 antibody

Immunohistochemical staining of human Intestine tissue using NACC1 antibody