Cart summary

You have no items in your shopping cart.

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2089599

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089599
CategoryAntibodies
DescriptionNaaladl2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW38kDa
Protein SequenceSynthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND
NCBIXP_915927
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGm1021, EG635702, 2810043G22Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.