NAALAD2 Rabbit Polyclonal Antibody

• Catalog Number: orb579827
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NAALAD2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAALAD2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 84 kDa
• Target: NAALAD2
• UniProt ID: Q9Y3Q0
• Protein Sequence: Synthetic peptide located within the following region: HYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPPY
• NCBI: NP_001287859.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GCPIII, GPCIII, NAADALASE2, NAALADASE2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide is present in 84 kDa as well as several other isoforms including 34 kDa and 29 kDa. The protein may be glycosylated.

Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.