You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580569 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NARG1L |
Target | NAA16 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NARG1L |
Protein Sequence | Synthetic peptide located within the following region: ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA |
UniProt ID | B0QZ59 |
MW | 50kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NARG1L |
Note | For research use only |
NCBI | NP_001104268 |
Human Muscle
WB Suggested Anti-NARG1L Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. NAA16 is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
PE |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
BF405 |