N6AMT1 Rabbit Polyclonal Antibody

• Catalog Number: orb579590
• Category: Antibodies
• Description: Rabbit polyclonal antibody to N6AMT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human N6AMT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20kDa
• Target: N6AMT1
• UniProt ID: Q96F73
• Protein Sequence: Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
• NCBI: NP_877426
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KMT9, MTQ2, PrmC, HEMK2, N6AMT, PRED28, C21orf127,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate. N6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226.

WB Suggested Anti-N6AMT1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Mouse Brain lysate.