MZT1 Rabbit Polyclonal Antibody

• Catalog Number: orb587555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MZT1
• Target: MZT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MZT1
• Protein Sequence: Synthetic peptide located within the following region: LLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAA
• UniProt ID: Q08AG7
• MW: 9kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MOZART1, C13orf37
• Note: For research use only
• NCBI: NP_001065243

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.