MYPN Rabbit Polyclonal Antibody

• Catalog Number: orb584650
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYPN
• Target: MYPN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA
• UniProt ID: Q86TC9
• MW: 145kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MYOP, RCM4, CMH22, NEM11, CMD1DD
• Research Area: Cardiovascular Disease, Epigenetics
• Note: For research use only
• NCBI: NP_115967

Lanes: 1: 50 ug untransfected CHO lysate, 2: 50 ug hMYPN-GFP transfected CHO lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-RPF, Secondary Antibody dilution: 1:10000, Gene Name: MYPN.

WB Suggested Anti-MYPN Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.