You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
MYPN Rabbit Polyclonal Antibody
Catalog Number: orb584650
| Catalog Number | orb584650 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MYPN |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 145kDa |
| Target | MYPN |
| UniProt ID | Q86TC9 |
| Protein Sequence | Synthetic peptide located within the following region: PVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIMA |
| NCBI | NP_115967 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | MYOP, RCM4, CMH22, NEM11, CMD1DD Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Lanes: 1: 50 ug untransfected CHO lysate, 2: 50 ug hMYPN-GFP transfected CHO lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-RPF, Secondary Antibody dilution: 1:10000, Gene Name: MYPN.
WB Suggested Anti-MYPN Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
- Item 1 of 2
- Item 1 of 2
MYPN Rabbit Polyclonal Antibody [orb157923]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
