You have no items in your shopping cart.
Cart summary
Item 1 of 1
MYO1A Rabbit Polyclonal Antibody
Catalog Number: orb589201
| Catalog Number | orb589201 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MYO1A |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MYO1A |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 75 kDa |
| Target | MYO1A |
| UniProt ID | G3V342 |
| Protein Sequence | Synthetic peptide located within the following region: KEEQEEYKREGIPWTKVDYFDNGIICKLIEHNQRGILAMLDEECLRPGVV |
| NCBI | NP_001242970.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | BBMI, MIHC, MYHL, DFNA48 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Liver Tumor lysates, Antibody Dilution: 1 ug/ml.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 2
MYO1A Antibody [orb629105]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
- Item 1 of 1
