MYH9 Rabbit Polyclonal Antibody

• Catalog Number: orb580273
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYH9
• Target: MYH9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYH9
• Protein Sequence: Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK
• UniProt ID: P35579
• MW: 226kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MHA, FTNS, EPSTS, BDPLT6, DFNA17, MATINS, NMMHCA,
• Note: For research use only
• NCBI: NP_002464

MYH9 antibody - middle region (orb580273) validated by WB using Hek 293 Whole Cell Lysate at 1:4000.

WB Suggested Anti-MYH9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: MCF7 cell lysate.