MYH1 Rabbit Polyclonal Antibody

• Catalog Number: orb578409
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 223 kDa
• Target: MYH1
• UniProt ID: P12882
• Protein Sequence: Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
• NCBI: NP_005954
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human OVCAR-3, Antibody Dilution: 1.0 ug/ml.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/ml. MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3.

Rabbit Anti-MYH1 Antibody, Catalog Number: orb578409, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MYH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.