Cart summary

You have no items in your shopping cart.

MYH1 Rabbit Polyclonal Antibody

SKU: orb578409

Description

Rabbit polyclonal antibody to MYH1

Research Area

Disease Biomarkers

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
Application Notes
Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%.

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenA synthetic peptide directed towards the N terminal region of human MYH1 : KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
TargetMYH1
Molecular Weight223 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
DisclaimerFor research use only

Alternative Names

MYHa, HEL71, MYHSA1, MyHC-2x, MyHC-2X/D

Similar Products

  • MYH1 Rabbit Polyclonal Antibody [orb2563457]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • MYH-pan rabbit pAb Antibody [orb767032]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • MYH1 Antibody [orb629077]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • MYH1 Antibody [orb629078]

    ELISA,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Fast Myosin Skeletal Heavy chain Rabbit Polyclonal Antibody [orb101070]

    ELISA

    Canine, Gallus, Human, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MYH1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

MYH1 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3, Antibody Dilution: 1.0 ug/ml.

MYH1 Rabbit Polyclonal Antibody

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/ml. MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3.

MYH1 Rabbit Polyclonal Antibody

Rabbit Anti-MYH1 Antibody, Catalog Number: orb578409, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

MYH1 Rabbit Polyclonal Antibody

WB Suggested Anti-MYH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005954

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MYH1 Rabbit Polyclonal Antibody (orb578409)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry