You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592864 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYBL2 |
Target | MYBL2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYBL2 |
Protein Sequence | Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK |
UniProt ID | P10244 |
MW | 79kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BMYB, B-MYB |
Note | For research use only |
NCBI | NP_002457 |
Human Spermatophore
WB Suggested Anti-MYBL2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. MYBL2 is supported by BioGPS gene expression data to be expressed in HepG2.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Human, Mouse, Plant, Rat | |
Polyclonal | |
Unconjugated |