Mybbp1a Rabbit Polyclonal Antibody

SKU: orb576459

Description

Rabbit polyclonal antibody to Mybbp1a

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Mybbp1a
• Target: Mybbp1a
• Protein Sequence: Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG
• Molecular Weight: 152kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: Mybbp1a.

WB Suggested Anti-Mybbp1a Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.

Quick Database Links

Gene Symbol

Mybbp1a

UniProt

Q7TPV4

RefSeq (Protein):NP_058056