Mybbp1a Rabbit Polyclonal Antibody

• Catalog Number: orb576459
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Mybbp1a
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Mybbp1a
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 152kDa
• Target: Mybbp1a
• UniProt ID: Q7TPV4
• Protein Sequence: Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG
• NCBI: NP_058056
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU01
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: Mybbp1a.

WB Suggested Anti-Mybbp1a Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.