You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579657 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MX1 |
| Target | MX1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MX1 |
| Protein Sequence | Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG |
| UniProt ID | P20591 |
| MW | 75kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MX, MxA, IFI78, IFI-78K, lncMX1-215 |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| NCBI | NP_002453 |
| Expiration Date | 12 months from date of receipt. |

Sample Tissue: Human 786-0, Antibody dilution: 1.0 ug/ml.

MX1 antibody - C-terminal region (orb579657) validated by WB using human LCL at 1:1000.

Rabbit Anti-MX1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Bovine, Human, Monkey, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review