You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325073 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MUL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C1orf166 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | MUL1 |
UniProt ID | Q969V5 |
Protein Sequence | Synthetic peptide located within the following region: GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ |
NCBI | NP_078820 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ12875 antibody, anti RP11-401M16.2 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL ug/mL of the antibody was used in this experiment. 40 kDa band likely has ubiquitin crosslinks and smaller isoforms of 34 kDa and 28 kDa also contain this peptide sequence.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/mL.
Positive control (+): Human kidney (KI), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.
WB Suggested Anti-C1orf166 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |