MTUS1 Rabbit Polyclonal Antibody

• Catalog Number: orb579162
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MTUS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTUS1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 141kDa
• Target: MTUS1
• UniProt ID: Q9ULD2
• Protein Sequence: Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
• NCBI: NP_001001924
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ATBP, ATIP, ICIS, MP44, ATIP3, MTSG1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.

Rabbit Anti-MTUS1 Antibody, Catalog Number: orb579162, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.