You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
MTNR1A Rabbit Polyclonal Antibody
Catalog Number: orb331138
| Catalog Number | orb331138 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MTNR1A |
| Target | MTNR1A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV |
| UniProt ID | P48039 |
| MW | 39kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti MEL-1A-R antibody, anti MT1 antibody |
| Note | For research use only |
| NCBI | NP_005949 |
Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-MTNR1A Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
- Item 1 of 1
MTNR1A Rabbit Polyclonal Antibody [orb221456]
WB
Bovine, Canine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 3
- Item 1 of 1
Anti-Melatonin Receptor 1a Antibody [orb234902]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 1
MTNR1A Antibody [orb223459]
IF
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μg, 100 μg, 25 μg, 50 μg
