You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586858 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MTMR7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTMR7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | MTMR7 |
UniProt ID | Q9Y216 |
Protein Sequence | Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL |
NCBI | NP_004677 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Sample Type: HT1080 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human kidney (KI), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/ml.
IHC-Fr, IHC-P | |
Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
HRP |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |