FAM54A Rabbit Polyclonal Antibody

• Catalog Number: orb581490
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM54A
• Target: MTFR2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: ENRSWESSPFSSPETSRFGHHISQSEGQRTKEEMVNTKAVDQGISNTSLL
• UniProt ID: Q6P444
• MW: 42kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DUFD1, FAM54A
• Note: For research use only
• NCBI: NP_612428

WB Suggested Anti-FAM54A Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.