Cart summary

You have no items in your shopping cart.

FAM54A Rabbit Polyclonal Antibody (HRP)

FAM54A Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2110139

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2110139
CategoryAntibodies
DescriptionFAM54A Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityEquine, Human
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein SequenceSynthetic peptide located within the following region: ENRSWESSPFSSPETSRFGHHISQSEGQRTKEEMVNTKAVDQGISNTSLL
UniProt IDQ6P444
MW42kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDUFD1, FAM54A
NoteFor research use only
NCBINP_612428