MTA2 Rabbit Polyclonal Antibody

• Catalog Number: orb576228
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MTA2
• Target: MTA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP
• UniProt ID: Q9R190
• MW: 73kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797
• Note: For research use only
• NCBI: NP_035972

WB Suggested Anti-MTA2 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:312500, Positive Control: NIH/3T3 cell lysate.