MRS2L Rabbit Polyclonal Antibody

• Catalog Number: orb325484
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MRS2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRS2L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: MRS2
• UniProt ID: Q9HD23
• Protein Sequence: Synthetic peptide located within the following region: LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL
• NCBI: NP_065713
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HPT antibody, anti MGC78523 antibody, anti MR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Stomach Tumor (T-ST), Negative control (-): SH-SY5Y Cell Lysate (N19), Antibody concentration: 1 ug/mL.

WB Suggested Anti-MRS2L Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate.