You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586706 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MRPL36 |
Target | MRPL36 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL36 |
Protein Sequence | Synthetic peptide located within the following region: PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM |
UniProt ID | Q9P0J6 |
MW | 11kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | RPMJ, BRIP1, L36mt, PRPL36, MRP-L36 |
Note | For research use only |
NCBI | NP_115868 |
Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rabbit | |
Polyclonal | |
Unconjugated |