Cart summary

You have no items in your shopping cart.

MPV17L Rabbit Polyclonal Antibody (FITC)

MPV17L Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104653

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104653
CategoryAntibodies
DescriptionMPV17L Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityGuinea pig, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MPV17L
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW17kDa
UniProt IDQ2QL34
Protein SequenceSynthetic peptide located within the following region: MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR
NCBINP_776164
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesM-LPH, MLPH1, MLPH2, MPV17L1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.