You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325046 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MPP5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MPP5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 77kDa |
Target | MPP5 |
UniProt ID | Q8N3R9 |
Protein Sequence | Synthetic peptide located within the following region: AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM |
NCBI | NP_071919 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ12615 antibody, anti PALS1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Liver tissue using MPP5 antibody
Western blot analysis of human Fetal Heart tissue using MPP5 antibody
Western blot analysis of Jurkat cell lysate tissue using MPP5 antibody
Western blot analysis of human Placenta tissue using MPP5 antibody
Western blot analysis of human Fetal Lung tissue using MPP5 antibody
ELISA, FC, IF, IHC | |
Bovine, Canine, Human, Porcine | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating