You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359270 |
---|---|
Category | Proteins |
Description | Recombinant mouse SHH active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 95% as determined by SDS-PAGE and HPLC. |
MW | 19.8 kDa |
UniProt ID | Q62226 |
Protein Sequence | GPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Protein Length | Partial |
Source | E.Coli |
Expression System | Expression Region: 26-198aa. Protein Length: Partial |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H10T1/2 cells is 0.5 - 1.0 μg/ml. |
Expression Region | 26-198aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl |
Alternative names | SHH, ,; Sonic hedgehog protein C-product Sonic hed Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse SHH protein (Active)
20 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
20 kDa, observed by non-reducing SDS-PAGE. | |
CHO |
Filter by Rating