Cart summary

You have no items in your shopping cart.

RecombinantShh,Mouse(CHO-expressed)

RecombinantShh,Mouse(CHO-expressed)

Catalog Number: orb1494667

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494667
CategoryProteins
DescriptionMembers of the Hedgehog (Hh) family are highly conserved proteins which are widely represented throughout the animal kingdom. The three known mammalian Hh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh) are structurally related and share a high degree of amino-acid sequence identity (e.g., Shh and Ihh are 93% identical). The biologically active form of Hh molecules is obtained by autocatalytic cleavage of their precursor proteins and corresponds to approximately the N-terminal one half of the precursor molecule. Although Hh proteins have unique expression patterns and distinct biological roles within their respective regions of secretion, they use the same signaling pathway and can substitute for each other in experimental systems. Recombinant E.coli derived Human Sonic HedgeHog is a 20.0 kDa protein consisting of 176 amino acid residues, including an N-terminal Ile-Val-Ile sequence substituted for the natural occurring chemically modified Cys residue.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHC SVKAENSVAAKSGG
MW20 kDa, observed by non-reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 1 x 10ˆ3 units/mg.
StorageLyophilized recombinant Murine Sonic Hedgehog (SHH) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmSHH should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesSHH, HHG-1
NoteFor research use only