Mouse RANKL protein

SKU: orb358674

Description

This Mouse RANKL protein spans the amino acid sequence from region 70-316aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  This is His-SUMO-tag protein

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 43.9 kDa
• Expression Region: 70-316aa
• Protein Length: Extracellular Domain
• Protein Sequence: YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

CD254 protein, hRANKL2 protein, ODF protein, OPGL protein, Osteoclast differentiation factor protein, Osteoprotegerin ligand protein, Receptor activator of nuclear factor kappa B ligand protein, Receptor activator of nuclear factor kappa-B ligand protein, TNF related activation induced cytokine protein, TNF-related activation-induced cytokine protein, TNFSF 11 protein, TNFSF11 protein, TRANCE protein, Tumor necrosis factor (ligand) superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11, soluble form protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

O35235