You have no items in your shopping cart.
Mouse RANKL protein
SKU: orb358674
Featured
Description
Research Area
Developmental Biology, Epigenetics
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 43.9 kDa |
| Expression Region | 70-316aa |
| Protein Length | Extracellular Domain |
| Protein Sequence | YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD254 protein, hRANKL2 protein, ODF protein, OPGL protein, Osteoclast differentiation factor protein, Osteoprotegerin ligand protein, Receptor activator of nuclear factor kappa B ligand protein, Receptor activator of nuclear factor kappa-B ligand protein, TNF related activation induced cytokine protein, TNF-related activation-induced cytokine protein, TNFSF 11 protein, TNFSF11 protein, TRANCE protein, Tumor necrosis factor (ligand) superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11, soluble form protein
Similar Products
−Recombinant Mouse CD254/RANKL/TNFSF11 Protein, N-His [orb3154536]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
29.86 kDa
50 μg, 100 μg, 1 mgRecombinant Mouse CD254/RANKL/TNFSF11 Protein, N-His-SUMO [orb2963804]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
29.85 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse RANKL protein (orb358674)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

