You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358252 |
---|---|
Category | Proteins |
Description | Recombinant mouse PSAP protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG |
Protein Length | Full Length |
UniProt ID | P20097 |
MW | 10.9 kDa |
Application notes | This is His-tag protein |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Cavia porcellus (Guinea pig) |
Expression Region | 1-81aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Co-beta-glucosidaseGlucosylceramidase activatorSph Read more... |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Mouse | |
3.12 pg/mL-200 pg/mL | |
0.78 pg/mL |
Mouse | |
0.31-20 ng/mL | |
0.19 ng/mL |