Cart summary

You have no items in your shopping cart.

Mouse LIF Protein

SKU: orb426882

Description

Recombinant of mouse LIF protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceEscherichia Coli
Biological ActivityActivity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Protein SequenceMSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF
PurityGreater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesLeukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.

Similar Products

  • Mouse LIF Protein, His Tag [orb334910]

    Unconjugated

    90%

    20.8 kDa

    1 mg, 50 μg
  • Mouse LIF Protein [orb1146996]

    Unconjugated

    90%

    20.0 kDa

    20 μg, 50 μg, 1 mg
  • Lif (NM_008501) Mouse Recombinant Protein [orb3035939]

    >95% as determined by SDS-PAGE and Coomassie blue staining

    19.9 kDa

    20 μg, 1 mg
  • Recombinant Mouse LIF Protein, C-His [orb2966617]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    22.96 kDa

    1 mg, 50 μg, 100 μg
  • Recombinant Mouse LIF Protein, N-His-SUMO [orb3153022]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    33.84 kDa

    50 μg, 100 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Mouse LIF Protein (orb426882)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
25 μg
$ 350.00
1 mg
$ 3,350.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry