You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies. |
| Purity | Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Protein Sequence | MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF |
Storage & Handling
−| Storage | Stability: Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse LIF Protein, N-His-SUMO [orb3153022]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
33.84 kDa
50 μg, 100 μg, 1 mgRecombinant Mouse LIF Protein, C-His [orb2966617]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
22.96 kDa
1 mg, 50 μg, 100 μgLif (NM_008501) Mouse Recombinant Protein [orb3035939]
>95% as determined by SDS-PAGE and Coomassie blue staining
19.9 kDa
20 μg, 1 mgRecombinant Mouse LIF Protein [orb3002423]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.9 KDa. Observed: 18 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Request a Document
Protocol Information
Mouse LIF Protein (orb426882)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review