Mouse Interferon gamma protein

• Catalog Number: orb604016
• Category: Proteins
• Description: Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)
• Tag: N-terminal GST-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
• Protein Length: Full Length of Mature Protein
• UniProt ID: P17515
• MW: 35.7 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Not test.
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Expression Region: 22-98aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: 10KDA interferon gamma-induced protein Short name,
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.