You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419313 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-36 gamma active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
MW | 17.3 kDa |
UniProt ID | Q8R460 |
Protein Sequence | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Expression System | 13-164aa |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg. |
Expression Region | 13-164aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20 |
Alternative names | Interleukin-1 family member 9, Read more... |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse IL36G protein
Mouse | |
7.81-500pg/mL | |
2.6pg/mL |
Filter by Rating