You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Fcgr3 protein
Catalog Number: orb358359
| Catalog Number | orb358359 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Fcgr3 protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT |
| Protein Length | Extracellular Domain |
| UniProt ID | P08508 |
| MW | 37.2 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 31-215aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fc-gamma RIII Short name, FcRIII CD_antigen, CD16 |
| Research Area | Epigenetics |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
- Item 1 of 1
Mouse Fcgr3 protein [orb358914]
Greater than 90% as determined by SDS-PAGE.
25.2 kDa
Mammalian cell
20 μg, 1 mg, 100 μg 
Mouse FCGR3 protein [orb707116]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgMouse FCGR3 protein [orb707117]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgRecombinant Mouse Fc γ RIIIA/FCGR3/CD16 Protein, His Tag [orb1550760]
> 95% by SDS-PAGE.
Recombinant Mouse Fc �� RIIIA/FCGR3/CD16 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ala31-Thr215) of mouse Fc �� RIIIA/FCGR3/CD16 (Accession #P08508) fused with a 6��His Tag at the C-terminus.
50 μg
