Mouse Fcgr3 protein

Catalog Number: orb358359

Catalog Number	orb358359
Category	Proteins
Description	Recombinant mouse Fcgr3 protein
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	37.2 kDa
UniProt ID	P08508
Protein Sequence	ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Protein Length	Extracellular Domain
Source	E.coli
Expression System	Expression Region: 31-215aa. Protein Length: Extracellular Domain
Expression Region	31-215aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Fc-gamma RIII Short name, FcRIII CD_antigen, CD16 Read more...
Note	For research use only
Application notes	This is His-SUMO-tag protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1729, Recombinant Mouse Fc γ RIIIA/FCGR3/CD16 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ala31-Thr215) of mouse Fc γ RIIIA/FCGR3/CD16 (Accession #P08508) fused with a 6×His Tag at the C-terminus.

Sizes Available: 500 μg, 50 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	25.2 kDa
Source:	Mammalian cell

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Fcgr3(Ala31-Thr215) was fused with the C-terminal His Tag and expressed in Mammalian cells.