Cart summary

You have no items in your shopping cart.

Mouse Endoglin Protein

SKU: orb425310

Description

Recombinant of mouse Endoglin protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceInsect Cells
Biological ActivityMeasured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Protein SequenceMDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVT FTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVF LVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWA ATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTP VQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVS WFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFV ELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMT LALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVV SNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQV SVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSF LLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
PurityGreater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD105 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesEndoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing no additives.
DisclaimerFor research use only

Alternative Names

CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Cell surface MJ7/18 antigen, Endoglin.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Mouse Endoglin Protein (orb425310)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

2 μg
$ 250.00
10 μg
$ 350.00
100 μg
$ 1,440.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry