You have no items in your shopping cart.
Cart summary
Mouse APRIL protein
Catalog Number: orb1216262
| Catalog Number | orb1216262 |
|---|---|
| Category | Proteins |
| Description | The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583). |
| Target | APRIL |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) |
| Protein Length | 146 |
| MW | 16.4 kDa |
| Source | Yeast |
| Biological Origin | Mouse |
| Storage | -20°C |
| Alternative names | TNFSF13 |
| Note | For research use only |
- Item 1 of 2
- Item 1 of 1
APRIL/TNFSF13 Protein, Mouse, Recombinant (hFc) [orb1961807]
98.00%
50-60 KDa (reducing condition)
1 mg, 500 μg, 50 μg, 10 μgBCMA/TNFRSF17 Protein, Human, Recombinant (His & Flag) [orb1962148]
98.00%
(11-14)&(16-26) KDa (reducing condition)
1 mg, 500 μg, 50 μg, 10 μgAPRIL/TNFSF13 Protein, Mouse, Recombinant (His & Flag) [orb1959769]
98.00%
18.53 kDa (predicted). Due to glycosylation, the protein migrates to 24-30 kDa based on Tris-Bis PAGE result.
100 μg, 500 μg, 1 mg
