Recombinant Mouse APRIL

• Catalog Number: orb623193
• Category: Proteins
• Description: A proliferation-inducing ligand (APRIL), also known as TNFSF13, is a member of the tumor necrosis factor (TNF) ligand superfamily. APRIL/TNFSF13 has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development. Mouse APRIL Recombinant Protein is purified APRIL (TNFSF13) produced in yeast.
• Form/Appearance: Lyophilized
• MW: 16.4 kDa
• Protein Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYL LYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDI ITVKIPRANAKLSLSPHGTFLGFVKL (146)
• Source: Yeast
• Storage: -20°C
• Note: For research use only
• Application notes: The Mouse VEGF-A protein can be used in cell culture, as a VEGF-A ELISA Standard, and as a Western Blot Control.
• Expiration Date: 6 months from date of receipt.