You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb98341 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal to Integrin alpha 3B |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 |
Conjugation | Unconjugated |
Reactivity | Human |
Form/Appearance | Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide. |
Buffer/Preservatives | Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide. |
UniProt ID | P26006 |
Tested applications | ICC, IHC-Fr, WB |
Antibody Type | Primary Antibody |
Clone Number | 54B3 |
Source | 54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Hazard Information | This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Biorbyt accepts no liability for any inaccuracies or omissions in this information. |
Note | For research use only |