Cart summary

You have no items in your shopping cart.

MOSPD3 Rabbit Polyclonal Antibody (FITC)

MOSPD3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2118582

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2118582
CategoryAntibodies
DescriptionMOSPD3 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MOSPD3
Protein SequenceSynthetic peptide located within the following region: FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM
UniProt IDO75425
MW24kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCDS3, NET30
NoteFor research use only
NCBINP_001035188
Images
Reviews

MOSPD3 Rabbit Polyclonal Antibody (FITC) (orb2118582)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet