You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330600 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MOGAT2 |
Target | MOGAT2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MOGAT2 |
Protein Sequence | Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN |
UniProt ID | Q3SYC2 |
MW | 38kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti DGAT2L5 antibody, anti FLJ22644 antibody, ant Read more... |
Note | For research use only |
NCBI | NP_079374 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-MOGAT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |