Cart summary

You have no items in your shopping cart.

MOAP1 Rabbit Polyclonal Antibody (Biotin)

MOAP1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2101363

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101363
CategoryAntibodies
DescriptionMOAP1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human MOAP1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW38kDa
UniProt IDQ96BY2
Protein SequenceSynthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP
NCBINP_071434
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMAP-1, PNMA4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.