You have no items in your shopping cart.
MMP19 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP19 |
| Target | MMP19 |
| Protein Sequence | Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR |
| Molecular Weight | 56kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MMP19 Rabbit Polyclonal Antibody [orb1786110]
ELISA, FC, ICC, IF, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human urinary bladder

Human urinary bladder

Sample Type: Control-Human small intestine, Sample-Human colorectal cancer, Primary Antibody dilution: 1:100, Secondary Antibody: Biotinylated pig anti-rabbit+streptavidin-HRP, Color/Signal Descriptions: MMP19: Brown DAPI:Blue, Gene Name: MMP19.

WB Suggested Anti-MMP19 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
MMP19 Rabbit Polyclonal Antibody (orb574131)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








