You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575419 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MLC1 |
| Target | MLC1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MLC1 |
| Protein Sequence | Synthetic peptide located within the following region: SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL |
| UniProt ID | Q15049 |
| MW | 41kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | VL, LVM, MLC |
| Research Area | Cell Biology, Pharmacology & Drug Discovery |
| Note | For research use only |
| NCBI | NP_055981 |

Sample Type: Human Fetal Spleen, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

Sample type: Rat Astrocytes dilution: 1:50.

WB Suggested Anti-MLC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Spleen.
IF, IHC-Fr, IHC-P | |
Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |
IF | |
Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
IHC-Fr, IHC-P | |
Canine, Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review