MLC1 Rabbit Polyclonal Antibody

• Catalog Number: orb575419
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MLC1
• Target: MLC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MLC1
• Protein Sequence: Synthetic peptide located within the following region: SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL
• UniProt ID: Q15049
• MW: 41kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: VL, LVM, MLC
• Research Area: Cell Biology, Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_055981

Sample Type: Human Fetal Spleen, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

Sample type: Rat Astrocytes dilution: 1:50.

WB Suggested Anti-MLC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Spleen.